Anti PASD1 pAb (ATL-HPA011122 w/enhanced validation)

Atlas

Catalog No: ATL-HPA011122-25

• 
• 

Protein Description: PAS domain containing 1
Gene Name: PASD1
Alternative Gene Name: CT63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047751: 24%, ENSRNOG00000001738: 23%
Entrez Gene ID: 139135
Uniprot ID: Q8IV76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSL
• Gene Sequence: QQDPENPVAPLDQAGLMDPVDPEDSVDLGAAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSL
• Gene ID - Mouse: ENSMUSG00000047751
• Gene ID - Rat: ENSRNOG00000001738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PASD1 pAb (ATL-HPA011122 w/enhanced validation) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.