Anti PARP9 pAb (ATL-HPA066708)

Atlas Antibodies

Catalog No: ATL-HPA066708-25

• 
• 

Product Description

Protein Description: poly (ADP-ribose) polymerase family, member 9
Gene Name: PARP9
Alternative Gene Name: BAL, BAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022906: 71%, ENSRNOG00000023463: 71%
Entrez Gene ID: 83666
Uniprot ID: Q8IXQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAA
• Gene Sequence: IDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAA
• Gene ID - Mouse: ENSMUSG00000022906
• Gene ID - Rat: ENSRNOG00000023463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.