Protein Description: poly (ADP-ribose) polymerase family, member 9
Gene Name: PARP9
Alternative Gene Name: BAL, BAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022906: 71%, ENSRNOG00000023463: 71%
Entrez Gene ID: 83666
Uniprot ID: Q8IXQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PARP9
Alternative Gene Name: BAL, BAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022906: 71%, ENSRNOG00000023463: 71%
Entrez Gene ID: 83666
Uniprot ID: Q8IXQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAA |
| Documents & Links for Anti PARP9 pAb (ATL-HPA066708) | |
| Datasheet | Anti PARP9 pAb (ATL-HPA066708) Datasheet (External Link) |
| Vendor Page | Anti PARP9 pAb (ATL-HPA066708) at Atlas |
| Documents & Links for Anti PARP9 pAb (ATL-HPA066708) | |
| Datasheet | Anti PARP9 pAb (ATL-HPA066708) Datasheet (External Link) |
| Vendor Page | Anti PARP9 pAb (ATL-HPA066708) |