Protein Description: parkin RBR E3 ubiquitin protein ligase
Gene Name: PARK2
Alternative Gene Name: AR-JP, parkin, PDJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023826: 91%, ENSRNOG00000007818: 27%
Entrez Gene ID: 5071
Uniprot ID: O60260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PARK2
Alternative Gene Name: AR-JP, parkin, PDJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023826: 91%, ENSRNOG00000007818: 27%
Entrez Gene ID: 5071
Uniprot ID: O60260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS |
| Documents & Links for Anti PARK2 pAb (ATL-HPA036012) | |
| Datasheet | Anti PARK2 pAb (ATL-HPA036012) Datasheet (External Link) |
| Vendor Page | Anti PARK2 pAb (ATL-HPA036012) at Atlas |
| Documents & Links for Anti PARK2 pAb (ATL-HPA036012) | |
| Datasheet | Anti PARK2 pAb (ATL-HPA036012) Datasheet (External Link) |
| Vendor Page | Anti PARK2 pAb (ATL-HPA036012) |
| Citations for Anti PARK2 pAb (ATL-HPA036012) – 1 Found |
| Mussazhanova, Zhanna; Shimamura, Mika; Kurashige, Tomomi; Ito, Masahiro; Nakashima, Masahiro; Nagayama, Yuji. Causative role for defective expression of mitochondria-eating protein in accumulation of mitochondria in thyroid oncocytic cell tumors. Cancer Science. 2020;111(8):2814-2823. PubMed |