Anti PARK2 pAb (ATL-HPA036012)

Catalog No:
ATL-HPA036012-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: parkin RBR E3 ubiquitin protein ligase
Gene Name: PARK2
Alternative Gene Name: AR-JP, parkin, PDJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023826: 91%, ENSRNOG00000007818: 27%
Entrez Gene ID: 5071
Uniprot ID: O60260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
Gene Sequence LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECS
Gene ID - Mouse ENSMUSG00000023826
Gene ID - Rat ENSRNOG00000007818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti PARK2 pAb (ATL-HPA036012)
Datasheet Anti PARK2 pAb (ATL-HPA036012) Datasheet (External Link)
Vendor Page Anti PARK2 pAb (ATL-HPA036012) at Atlas

Documents & Links for Anti PARK2 pAb (ATL-HPA036012)
Datasheet Anti PARK2 pAb (ATL-HPA036012) Datasheet (External Link)
Vendor Page Anti PARK2 pAb (ATL-HPA036012)

Citations for Anti PARK2 pAb (ATL-HPA036012) – 1 Found
Mussazhanova, Zhanna; Shimamura, Mika; Kurashige, Tomomi; Ito, Masahiro; Nakashima, Masahiro; Nagayama, Yuji. Causative role for defective expression of mitochondria-eating protein in accumulation of mitochondria in thyroid oncocytic cell tumors. Cancer Science. 2020;111(8):2814-2823.  PubMed