Description
Product Description
Protein Description: progestin and adipoQ receptor family member VIII
Gene Name: PAQR8
Alternative Gene Name: C6orf33, LMPB1, MPRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025931: 96%, ENSRNOG00000012830: 98%
Entrez Gene ID: 85315
Uniprot ID: Q8TEZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAQR8
Alternative Gene Name: C6orf33, LMPB1, MPRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025931: 96%, ENSRNOG00000012830: 98%
Entrez Gene ID: 85315
Uniprot ID: Q8TEZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY |
Gene Sequence | MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPY |
Gene ID - Mouse | ENSMUSG00000025931 |
Gene ID - Rat | ENSRNOG00000012830 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PAQR8 pAb (ATL-HPA064625) | |
Datasheet | Anti PAQR8 pAb (ATL-HPA064625) Datasheet (External Link) |
Vendor Page | Anti PAQR8 pAb (ATL-HPA064625) at Atlas Antibodies |
Documents & Links for Anti PAQR8 pAb (ATL-HPA064625) | |
Datasheet | Anti PAQR8 pAb (ATL-HPA064625) Datasheet (External Link) |
Vendor Page | Anti PAQR8 pAb (ATL-HPA064625) |