Protein Description: progestin and adipoQ receptor family member VI
Gene Name: PAQR6
Alternative Gene Name: FLJ22672, PRdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 26%, ENSRNOG00000009723: 26%
Entrez Gene ID: 79957
Uniprot ID: Q6TCH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAQR6
Alternative Gene Name: FLJ22672, PRdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 26%, ENSRNOG00000009723: 26%
Entrez Gene ID: 79957
Uniprot ID: Q6TCH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL |
| Documents & Links for Anti PAQR6 pAb (ATL-HPA073505) | |
| Datasheet | Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link) |
| Vendor Page | Anti PAQR6 pAb (ATL-HPA073505) at Atlas |
| Documents & Links for Anti PAQR6 pAb (ATL-HPA073505) | |
| Datasheet | Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link) |
| Vendor Page | Anti PAQR6 pAb (ATL-HPA073505) |