Description
Product Description
Protein Description: progestin and adipoQ receptor family member VI
Gene Name: PAQR6
Alternative Gene Name: FLJ22672, PRdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 26%, ENSRNOG00000009723: 26%
Entrez Gene ID: 79957
Uniprot ID: Q6TCH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAQR6
Alternative Gene Name: FLJ22672, PRdelta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029675: 26%, ENSRNOG00000009723: 26%
Entrez Gene ID: 79957
Uniprot ID: Q6TCH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL |
Gene Sequence | YIGEGTPGPAREEAGADAFPEHRMNWATATSYSTSVQCWAPTSSWRQCWLIWDHAEPGWPHRNLPWAWQAQWPHWSWLQL |
Gene ID - Mouse | ENSMUSG00000029675 |
Gene ID - Rat | ENSRNOG00000009723 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PAQR6 pAb (ATL-HPA073505) | |
Datasheet | Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link) |
Vendor Page | Anti PAQR6 pAb (ATL-HPA073505) at Atlas Antibodies |
Documents & Links for Anti PAQR6 pAb (ATL-HPA073505) | |
Datasheet | Anti PAQR6 pAb (ATL-HPA073505) Datasheet (External Link) |
Vendor Page | Anti PAQR6 pAb (ATL-HPA073505) |