Protein Description: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
Gene Name: PAPSS2
Alternative Gene Name: ATPSK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024899: 85%, ENSRNOG00000011068: 81%
Entrez Gene ID: 9060
Uniprot ID: O95340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAPSS2
Alternative Gene Name: ATPSK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024899: 85%, ENSRNOG00000011068: 81%
Entrez Gene ID: 9060
Uniprot ID: O95340
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV |
Documents & Links for Anti PAPSS2 pAb (ATL-HPA071224) | |
Datasheet | Anti PAPSS2 pAb (ATL-HPA071224) Datasheet (External Link) |
Vendor Page | Anti PAPSS2 pAb (ATL-HPA071224) at Atlas |
Documents & Links for Anti PAPSS2 pAb (ATL-HPA071224) | |
Datasheet | Anti PAPSS2 pAb (ATL-HPA071224) Datasheet (External Link) |
Vendor Page | Anti PAPSS2 pAb (ATL-HPA071224) |