Protein Description: presequence translocase-associated motor 16 homolog (S. cerevisiae)
Gene Name: PAM16
Alternative Gene Name: Magmas, Tim16, TIMM16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045886: 94%, ENSRNOG00000004608: 94%
Entrez Gene ID: 51025
Uniprot ID: Q9Y3D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAM16
Alternative Gene Name: Magmas, Tim16, TIMM16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045886: 94%, ENSRNOG00000004608: 94%
Entrez Gene ID: 51025
Uniprot ID: Q9Y3D7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
| Documents & Links for Anti PAM16 pAb (ATL-HPA062721) | |
| Datasheet | Anti PAM16 pAb (ATL-HPA062721) Datasheet (External Link) |
| Vendor Page | Anti PAM16 pAb (ATL-HPA062721) at Atlas |
| Documents & Links for Anti PAM16 pAb (ATL-HPA062721) | |
| Datasheet | Anti PAM16 pAb (ATL-HPA062721) Datasheet (External Link) |
| Vendor Page | Anti PAM16 pAb (ATL-HPA062721) |