Protein Description: p21 protein (Cdc42/Rac)-activated kinase 4
Gene Name: PAK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030602: 98%, ENSRNOG00000019883: 98%
Entrez Gene ID: 10298
Uniprot ID: O96013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030602: 98%, ENSRNOG00000019883: 98%
Entrez Gene ID: 10298
Uniprot ID: O96013
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RQWQSLIEESARRPKPLVDPACITSIQPGAPKTIVRGSKGAKDGALTLLLDEFENM |
Documents & Links for Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) | |
Datasheet | Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) at Atlas |
Documents & Links for Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) | |
Datasheet | Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PAK4 pAb (ATL-HPA070175 w/enhanced validation) |