Protein Description: Paf1, RNA polymerase II associated factor, homolog (S. cerevisiae)
Gene Name: PAF1
Alternative Gene Name: F23149_1, FLJ11123, PD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003437: 100%, ENSRNOG00000019746: 100%
Entrez Gene ID: 54623
Uniprot ID: Q8N7H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PAF1
Alternative Gene Name: F23149_1, FLJ11123, PD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003437: 100%, ENSRNOG00000019746: 100%
Entrez Gene ID: 54623
Uniprot ID: Q8N7H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
| Gene Sequence | EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
| Gene ID - Mouse | ENSMUSG00000003437 |
| Gene ID - Rat | ENSRNOG00000019746 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PAF1 pAb (ATL-HPA041875) | |
| Datasheet | Anti PAF1 pAb (ATL-HPA041875) Datasheet (External Link) |
| Vendor Page | Anti PAF1 pAb (ATL-HPA041875) at Atlas |
| Documents & Links for Anti PAF1 pAb (ATL-HPA041875) | |
| Datasheet | Anti PAF1 pAb (ATL-HPA041875) Datasheet (External Link) |
| Vendor Page | Anti PAF1 pAb (ATL-HPA041875) |