Protein Description: peptidyl arginine deiminase, type I
Gene Name: PADI1
Alternative Gene Name: HPAD10, PAD1, PDI, PDI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025329: 82%, ENSRNOG00000007067: 82%
Entrez Gene ID: 29943
Uniprot ID: Q9ULC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PADI1
Alternative Gene Name: HPAD10, PAD1, PDI, PDI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025329: 82%, ENSRNOG00000007067: 82%
Entrez Gene ID: 29943
Uniprot ID: Q9ULC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN |
| Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) | |
| Datasheet | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) at Atlas |
| Documents & Links for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) | |
| Datasheet | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) |
| Citations for Anti PADI1 pAb (ATL-HPA062294 w/enhanced validation) – 1 Found |
| Casanova, Víctor; Sousa, Filipa Henderson; Shakamuri, Priyanka; Svoboda, Pavel; Buch, Chloé; D'Acremont, Mathilde; Christophorou, Maria A; Pohl, Jan; Stevens, Craig; Barlow, Peter G. Citrullination Alters the Antiviral and Immunomodulatory Activities of the Human Cathelicidin LL-37 During Rhinovirus Infection. Frontiers In Immunology. 11( 32117246):85. PubMed |