Anti PACSIN2 pAb (ATL-HPA056520 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA056520-25

• 

Product Description

Protein Description: protein kinase C and casein kinase substrate in neurons 2
Gene Name: PACSIN2
Alternative Gene Name: SDPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016664: 90%, ENSRNOG00000009756: 90%
Entrez Gene ID: 11252
Uniprot ID: Q9UNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLR
• Gene Sequence: FEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLR
• Gene ID - Mouse: ENSMUSG00000016664
• Gene ID - Rat: ENSRNOG00000009756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.