Protein Description: poly(A) binding protein, cytoplasmic 1-like
Gene Name: PABPC1L
Alternative Gene Name: C20orf119, dJ1069P2.3, ePAB, PABPC1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054582: 58%, ENSRNOG00000012750: 49%
Entrez Gene ID: 80336
Uniprot ID: Q4VXU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PABPC1L
Alternative Gene Name: C20orf119, dJ1069P2.3, ePAB, PABPC1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054582: 58%, ENSRNOG00000012750: 49%
Entrez Gene ID: 80336
Uniprot ID: Q4VXU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP |
Documents & Links for Anti PABPC1L pAb (ATL-HPA066650) | |
Datasheet | Anti PABPC1L pAb (ATL-HPA066650) Datasheet (External Link) |
Vendor Page | Anti PABPC1L pAb (ATL-HPA066650) at Atlas |
Documents & Links for Anti PABPC1L pAb (ATL-HPA066650) | |
Datasheet | Anti PABPC1L pAb (ATL-HPA066650) Datasheet (External Link) |
Vendor Page | Anti PABPC1L pAb (ATL-HPA066650) |