Protein Description: purinergic receptor P2Y, G-protein coupled, 10
Gene Name: P2RY10
Alternative Gene Name: P2Y10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050921: 91%, ENSRNOG00000037839: 91%
Entrez Gene ID: 27334
Uniprot ID: O00398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: P2RY10
Alternative Gene Name: P2Y10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050921: 91%, ENSRNOG00000037839: 91%
Entrez Gene ID: 27334
Uniprot ID: O00398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG |
Documents & Links for Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) | |
Datasheet | Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) at Atlas |
Documents & Links for Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) | |
Datasheet | Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti P2RY10 pAb (ATL-HPA065766 w/enhanced validation) |