Anti P2RX3 pAb (ATL-HPA057776)

Atlas Antibodies

Catalog No: ATL-HPA057776-25

• 

Product Description

Protein Description: purinergic receptor P2X, ligand-gated ion channel, 3
Gene Name: P2RX3
Alternative Gene Name: P2X3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027071: 92%, ENSRNOG00000008552: 92%
Entrez Gene ID: 5024
Uniprot ID: P56373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
• Gene Sequence: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
• Gene ID - Mouse: ENSMUSG00000027071
• Gene ID - Rat: ENSRNOG00000008552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.