Anti P2RX3 pAb (ATL-HPA057776)

Catalog No:
ATL-HPA057776-25
$303.00

Description

Product Description

Protein Description: purinergic receptor P2X, ligand-gated ion channel, 3
Gene Name: P2RX3
Alternative Gene Name: P2X3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027071: 92%, ENSRNOG00000008552: 92%
Entrez Gene ID: 5024
Uniprot ID: P56373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
Gene Sequence FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
Gene ID - Mouse ENSMUSG00000027071
Gene ID - Rat ENSRNOG00000008552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti P2RX3 pAb (ATL-HPA057776)
Datasheet Anti P2RX3 pAb (ATL-HPA057776) Datasheet (External Link)
Vendor Page Anti P2RX3 pAb (ATL-HPA057776) at Atlas Antibodies

Documents & Links for Anti P2RX3 pAb (ATL-HPA057776)
Datasheet Anti P2RX3 pAb (ATL-HPA057776) Datasheet (External Link)
Vendor Page Anti P2RX3 pAb (ATL-HPA057776)

Product Description

Protein Description: purinergic receptor P2X, ligand-gated ion channel, 3
Gene Name: P2RX3
Alternative Gene Name: P2X3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027071: 92%, ENSRNOG00000008552: 92%
Entrez Gene ID: 5024
Uniprot ID: P56373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
Gene Sequence FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY
Gene ID - Mouse ENSMUSG00000027071
Gene ID - Rat ENSRNOG00000008552
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti P2RX3 pAb (ATL-HPA057776)
Datasheet Anti P2RX3 pAb (ATL-HPA057776) Datasheet (External Link)
Vendor Page Anti P2RX3 pAb (ATL-HPA057776) at Atlas Antibodies

Documents & Links for Anti P2RX3 pAb (ATL-HPA057776)
Datasheet Anti P2RX3 pAb (ATL-HPA057776) Datasheet (External Link)
Vendor Page Anti P2RX3 pAb (ATL-HPA057776)