Anti OXT pAb (ATL-HPA071892)

Atlas Antibodies

Catalog No: ATL-HPA071892-25

• 

Product Description

Protein Description: oxytocin/neurophysin I prepropeptide
Gene Name: OXT
Alternative Gene Name: OT, OT-NPI, OXT-NPI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037727: 95%, ENSRNOG00000021225: 95%
Entrez Gene ID: 5020
Uniprot ID: P01178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
• Gene Sequence: ICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGS
• Gene ID - Mouse: ENSMUSG00000037727
• Gene ID - Rat: ENSRNOG00000021225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.