Anti OXLD1 pAb (ATL-HPA057019)

Catalog No:
ATL-HPA057019-25
$447.00

Description

Product Description

Protein Description: oxidoreductase-like domain containing 1
Gene Name: OXLD1
Alternative Gene Name: C17orf90, MGC104712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039670: 80%, ENSRNOG00000047517: 80%
Entrez Gene ID: 339229
Uniprot ID: Q5BKU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHT
Gene Sequence CCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHT
Gene ID - Mouse ENSMUSG00000039670
Gene ID - Rat ENSRNOG00000047517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OXLD1 pAb (ATL-HPA057019)
Datasheet Anti OXLD1 pAb (ATL-HPA057019) Datasheet (External Link)
Vendor Page Anti OXLD1 pAb (ATL-HPA057019) at Atlas Antibodies

Documents & Links for Anti OXLD1 pAb (ATL-HPA057019)
Datasheet Anti OXLD1 pAb (ATL-HPA057019) Datasheet (External Link)
Vendor Page Anti OXLD1 pAb (ATL-HPA057019)

Product Description

Protein Description: oxidoreductase-like domain containing 1
Gene Name: OXLD1
Alternative Gene Name: C17orf90, MGC104712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039670: 80%, ENSRNOG00000047517: 80%
Entrez Gene ID: 339229
Uniprot ID: Q5BKU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHT
Gene Sequence CCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHT
Gene ID - Mouse ENSMUSG00000039670
Gene ID - Rat ENSRNOG00000047517
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OXLD1 pAb (ATL-HPA057019)
Datasheet Anti OXLD1 pAb (ATL-HPA057019) Datasheet (External Link)
Vendor Page Anti OXLD1 pAb (ATL-HPA057019) at Atlas Antibodies

Documents & Links for Anti OXLD1 pAb (ATL-HPA057019)
Datasheet Anti OXLD1 pAb (ATL-HPA057019) Datasheet (External Link)
Vendor Page Anti OXLD1 pAb (ATL-HPA057019)