Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062205-25

• 

Product Description

Protein Description: oviductal glycoprotein 1, 120kDa
Gene Name: OVGP1
Alternative Gene Name: CHIT5, MUC9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045103: 26%, ENSRNOG00000022921: 28%
Entrez Gene ID: 5016
Uniprot ID: Q12889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE
• Gene Sequence: GTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDE
• Gene ID - Mouse: ENSMUSG00000045103
• Gene ID - Rat: ENSRNOG00000022921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti OVGP1 pAb (ATL-HPA062205 w/enhanced validation) – 2 Found

Yucer, Nur; Holzapfel, Marie; Jenkins Vogel, Tilley; Lenaeus, Lindsay; Ornelas, Loren; Laury, Anna; Sareen, Dhruv; Barrett, Robert; Karlan, Beth Y; Svendsen, Clive N. Directed Differentiation of Human Induced Pluripotent Stem Cells into Fallopian Tube Epithelium. Scientific Reports. 2017;7(1):10741. 

Yucer, Nur; Ahdoot, Rodney; Workman, Michael J; Laperle, Alexander H; Recouvreux, Maria S; Kurowski, Kathleen; Naboulsi, Diana J; Liang, Victoria; Qu, Ying; Plummer, Jasmine T; Gayther, Simon A; Orsulic, Sandra; Karlan, Beth Y; Svendsen, Clive N. Human iPSC-derived fallopian tube organoids with BRCA1 mutation recapitulate early-stage carcinogenesis. Cell Reports. 2021;37(13):110146.