Description
Product Description
Protein Description: ovarian tumor suppressor candidate 2
Gene Name: OVCA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038268: 85%, ENSRNOG00000000852: 31%
Entrez Gene ID: 124641
Uniprot ID: Q8WZ82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OVCA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038268: 85%, ENSRNOG00000000852: 31%
Entrez Gene ID: 124641
Uniprot ID: Q8WZ82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE |
Gene Sequence | PLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE |
Gene ID - Mouse | ENSMUSG00000038268 |
Gene ID - Rat | ENSRNOG00000000852 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti OVCA2 pAb (ATL-HPA059002) | |
Datasheet | Anti OVCA2 pAb (ATL-HPA059002) Datasheet (External Link) |
Vendor Page | Anti OVCA2 pAb (ATL-HPA059002) at Atlas Antibodies |
Documents & Links for Anti OVCA2 pAb (ATL-HPA059002) | |
Datasheet | Anti OVCA2 pAb (ATL-HPA059002) Datasheet (External Link) |
Vendor Page | Anti OVCA2 pAb (ATL-HPA059002) |