Protein Description: OTU deubiquitinase 7B
Gene Name: OTUD7B
Alternative Gene Name: CEZANNE, ZA20D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038495: 90%, ENSRNOG00000042068: 91%
Entrez Gene ID: 56957
Uniprot ID: Q6GQQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OTUD7B
Alternative Gene Name: CEZANNE, ZA20D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038495: 90%, ENSRNOG00000042068: 91%
Entrez Gene ID: 56957
Uniprot ID: Q6GQQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QGEGKFIFVGTLKMGHRHQYQEEMIQRYLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDA |
| Documents & Links for Anti OTUD7B pAb (ATL-HPA076357) | |
| Datasheet | Anti OTUD7B pAb (ATL-HPA076357) Datasheet (External Link) |
| Vendor Page | Anti OTUD7B pAb (ATL-HPA076357) at Atlas |
| Documents & Links for Anti OTUD7B pAb (ATL-HPA076357) | |
| Datasheet | Anti OTUD7B pAb (ATL-HPA076357) Datasheet (External Link) |
| Vendor Page | Anti OTUD7B pAb (ATL-HPA076357) |