Protein Description: oxysterol binding protein like 7
Gene Name: OSBPL7
Alternative Gene Name: MGC71150, ORP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038534: 94%, ENSRNOG00000009473: 95%
Entrez Gene ID: 114881
Uniprot ID: Q9BZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OSBPL7
Alternative Gene Name: MGC71150, ORP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038534: 94%, ENSRNOG00000009473: 95%
Entrez Gene ID: 114881
Uniprot ID: Q9BZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDSSGTRGLPPTDYAHLQRSFWALAQKVHSSL |
Documents & Links for Anti OSBPL7 pAb (ATL-HPA073967) | |
Datasheet | Anti OSBPL7 pAb (ATL-HPA073967) Datasheet (External Link) |
Vendor Page | Anti OSBPL7 pAb (ATL-HPA073967) at Atlas |
Documents & Links for Anti OSBPL7 pAb (ATL-HPA073967) | |
Datasheet | Anti OSBPL7 pAb (ATL-HPA073967) Datasheet (External Link) |
Vendor Page | Anti OSBPL7 pAb (ATL-HPA073967) |