Protein Description: origin recognition complex, subunit 6
Gene Name: ORC6
Alternative Gene Name: ORC6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031697: 61%, ENSRNOG00000024043: 54%
Entrez Gene ID: 23594
Uniprot ID: Q9Y5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ORC6
Alternative Gene Name: ORC6L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031697: 61%, ENSRNOG00000024043: 54%
Entrez Gene ID: 23594
Uniprot ID: Q9Y5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ |
| Documents & Links for Anti ORC6 pAb (ATL-HPA072587) | |
| Datasheet | Anti ORC6 pAb (ATL-HPA072587) Datasheet (External Link) |
| Vendor Page | Anti ORC6 pAb (ATL-HPA072587) at Atlas |
| Documents & Links for Anti ORC6 pAb (ATL-HPA072587) | |
| Datasheet | Anti ORC6 pAb (ATL-HPA072587) Datasheet (External Link) |
| Vendor Page | Anti ORC6 pAb (ATL-HPA072587) |