Protein Description: origin recognition complex, subunit 4
Gene Name: ORC4
Alternative Gene Name: HsORC4, ORC4L, Orc4p
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 5000
Uniprot ID: O43929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ORC4
Alternative Gene Name: HsORC4, ORC4L, Orc4p
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 5000
Uniprot ID: O43929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL |
| Documents & Links for Anti ORC4 pAb (ATL-HPA064562) | |
| Datasheet | Anti ORC4 pAb (ATL-HPA064562) Datasheet (External Link) |
| Vendor Page | Anti ORC4 pAb (ATL-HPA064562) at Atlas |
| Documents & Links for Anti ORC4 pAb (ATL-HPA064562) | |
| Datasheet | Anti ORC4 pAb (ATL-HPA064562) Datasheet (External Link) |
| Vendor Page | Anti ORC4 pAb (ATL-HPA064562) |