Protein Description: origin recognition complex, subunit 2
Gene Name: ORC2
Alternative Gene Name: ORC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026037: 69%, ENSRNOG00000012558: 70%
Entrez Gene ID: 4999
Uniprot ID: Q13416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ORC2
Alternative Gene Name: ORC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026037: 69%, ENSRNOG00000012558: 70%
Entrez Gene ID: 4999
Uniprot ID: Q13416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK |
Documents & Links for Anti ORC2 pAb (ATL-HPA073881) | |
Datasheet | Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link) |
Vendor Page | Anti ORC2 pAb (ATL-HPA073881) at Atlas |
Documents & Links for Anti ORC2 pAb (ATL-HPA073881) | |
Datasheet | Anti ORC2 pAb (ATL-HPA073881) Datasheet (External Link) |
Vendor Page | Anti ORC2 pAb (ATL-HPA073881) |