Anti ORC2 pAb (ATL-HPA073881)

Atlas Antibodies

Catalog No: ATL-HPA073881-25

• 
• 

Product Description

Protein Description: origin recognition complex, subunit 2
Gene Name: ORC2
Alternative Gene Name: ORC2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026037: 69%, ENSRNOG00000012558: 70%
Entrez Gene ID: 4999
Uniprot ID: Q13416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK
• Gene Sequence: MLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAK
• Gene ID - Mouse: ENSMUSG00000026037
• Gene ID - Rat: ENSRNOG00000012558
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.