Description
Product Description
Protein Description: oral cancer overexpressed 1
Gene Name: ORAOV1
Alternative Gene Name: TAOS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031072: 75%, ENSRNOG00000020903: 75%
Entrez Gene ID: 220064
Uniprot ID: Q8WV07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ORAOV1
Alternative Gene Name: TAOS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031072: 75%, ENSRNOG00000020903: 75%
Entrez Gene ID: 220064
Uniprot ID: Q8WV07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF |
Gene Sequence | GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF |
Gene ID - Mouse | ENSMUSG00000031072 |
Gene ID - Rat | ENSRNOG00000020903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ORAOV1 pAb (ATL-HPA062696) | |
Datasheet | Anti ORAOV1 pAb (ATL-HPA062696) Datasheet (External Link) |
Vendor Page | Anti ORAOV1 pAb (ATL-HPA062696) at Atlas Antibodies |
Documents & Links for Anti ORAOV1 pAb (ATL-HPA062696) | |
Datasheet | Anti ORAOV1 pAb (ATL-HPA062696) Datasheet (External Link) |
Vendor Page | Anti ORAOV1 pAb (ATL-HPA062696) |