Description
Product Description
Protein Description: olfactory receptor, family 13, subfamily D, member 1
Gene Name: OR13D1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033813: 33%, ENSRNOG00000001004: 31%
Entrez Gene ID: 286365
Uniprot ID: Q8NGV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OR13D1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033813: 33%, ENSRNOG00000001004: 31%
Entrez Gene ID: 286365
Uniprot ID: Q8NGV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV |
| Gene Sequence | ISIYLNHVLFYTTQQAGDLEHMETRNYSAMTEFFLV |
| Gene ID - Mouse | ENSMUSG00000033813 |
| Gene ID - Rat | ENSRNOG00000001004 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti OR13D1 pAb (ATL-HPA055921) | |
| Datasheet | Anti OR13D1 pAb (ATL-HPA055921) Datasheet (External Link) |
| Vendor Page | Anti OR13D1 pAb (ATL-HPA055921) at Atlas Antibodies |
| Documents & Links for Anti OR13D1 pAb (ATL-HPA055921) | |
| Datasheet | Anti OR13D1 pAb (ATL-HPA055921) Datasheet (External Link) |
| Vendor Page | Anti OR13D1 pAb (ATL-HPA055921) |