Protein Description: opioid receptor kappa 1
Gene Name: OPRK1
Alternative Gene Name: KOR, OPRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025905: 86%, ENSRNOG00000007647: 86%
Entrez Gene ID: 4986
Uniprot ID: P41145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OPRK1
Alternative Gene Name: KOR, OPRK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025905: 86%, ENSRNOG00000007647: 86%
Entrez Gene ID: 4986
Uniprot ID: P41145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV |
Documents & Links for Anti OPRK1 pAb (ATL-HPA067549) | |
Datasheet | Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link) |
Vendor Page | Anti OPRK1 pAb (ATL-HPA067549) at Atlas |
Documents & Links for Anti OPRK1 pAb (ATL-HPA067549) | |
Datasheet | Anti OPRK1 pAb (ATL-HPA067549) Datasheet (External Link) |
Vendor Page | Anti OPRK1 pAb (ATL-HPA067549) |