Protein Description: optic atrophy 1 (autosomal dominant)
Gene Name: OPA1
Alternative Gene Name: FLJ12460, KIAA0567, MGM1, NPG, NTG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038084: 100%, ENSRNOG00000001717: 100%
Entrez Gene ID: 4976
Uniprot ID: O60313
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OPA1
Alternative Gene Name: FLJ12460, KIAA0567, MGM1, NPG, NTG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038084: 100%, ENSRNOG00000001717: 100%
Entrez Gene ID: 4976
Uniprot ID: O60313
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHG |
Gene Sequence | KEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHG |
Gene ID - Mouse | ENSMUSG00000038084 |
Gene ID - Rat | ENSRNOG00000001717 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) | |
Datasheet | Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) | |
Datasheet | Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti OPA1 pAb (ATL-HPA036927 w/enhanced validation) |