Anti OLFML2B pAb (ATL-HPA062739)

Catalog No:
ATL-HPA062739-25
$303.00

Description

Product Description

Protein Description: olfactomedin-like 2B
Gene Name: OLFML2B
Alternative Gene Name: DKFZP586L151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038463: 69%, ENSRNOG00000003018: 64%
Entrez Gene ID: 25903
Uniprot ID: Q68BL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL
Gene Sequence YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL
Gene ID - Mouse ENSMUSG00000038463
Gene ID - Rat ENSRNOG00000003018
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OLFML2B pAb (ATL-HPA062739)
Datasheet Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link)
Vendor Page Anti OLFML2B pAb (ATL-HPA062739) at Atlas Antibodies

Documents & Links for Anti OLFML2B pAb (ATL-HPA062739)
Datasheet Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link)
Vendor Page Anti OLFML2B pAb (ATL-HPA062739)

Product Description

Protein Description: olfactomedin-like 2B
Gene Name: OLFML2B
Alternative Gene Name: DKFZP586L151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038463: 69%, ENSRNOG00000003018: 64%
Entrez Gene ID: 25903
Uniprot ID: Q68BL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL
Gene Sequence YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL
Gene ID - Mouse ENSMUSG00000038463
Gene ID - Rat ENSRNOG00000003018
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OLFML2B pAb (ATL-HPA062739)
Datasheet Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link)
Vendor Page Anti OLFML2B pAb (ATL-HPA062739) at Atlas Antibodies

Documents & Links for Anti OLFML2B pAb (ATL-HPA062739)
Datasheet Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link)
Vendor Page Anti OLFML2B pAb (ATL-HPA062739)