Description
Product Description
Protein Description: olfactomedin-like 2B
Gene Name: OLFML2B
Alternative Gene Name: DKFZP586L151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038463: 69%, ENSRNOG00000003018: 64%
Entrez Gene ID: 25903
Uniprot ID: Q68BL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OLFML2B
Alternative Gene Name: DKFZP586L151
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038463: 69%, ENSRNOG00000003018: 64%
Entrez Gene ID: 25903
Uniprot ID: Q68BL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL |
Gene Sequence | YKAKVSEEENDIEEQQDEFFSGDNGVDLLIEDQLLRHNGLMTSVTRRPAATRQGHSTAVTSDLNARTAPWSSAL |
Gene ID - Mouse | ENSMUSG00000038463 |
Gene ID - Rat | ENSRNOG00000003018 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti OLFML2B pAb (ATL-HPA062739) | |
Datasheet | Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link) |
Vendor Page | Anti OLFML2B pAb (ATL-HPA062739) at Atlas Antibodies |
Documents & Links for Anti OLFML2B pAb (ATL-HPA062739) | |
Datasheet | Anti OLFML2B pAb (ATL-HPA062739) Datasheet (External Link) |
Vendor Page | Anti OLFML2B pAb (ATL-HPA062739) |