Protein Description: olfactomedin 4
Gene Name: OLFM4
Alternative Gene Name: GC1, GW112, OlfD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022026: 54%, ENSRNOG00000013280: 77%
Entrez Gene ID: 10562
Uniprot ID: Q6UX06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OLFM4
Alternative Gene Name: GC1, GW112, OlfD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022026: 54%, ENSRNOG00000013280: 77%
Entrez Gene ID: 10562
Uniprot ID: Q6UX06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN |
| Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) | |
| Datasheet | Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) at Atlas |
| Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) | |
| Datasheet | Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) |
| Citations for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) – 1 Found |
| Uhlitz, Florian; Bischoff, Philip; Peidli, Stefan; Sieber, Anja; Trinks, Alexandra; Lüthen, Mareen; Obermayer, Benedikt; Blanc, Eric; Ruchiy, Yana; Sell, Thomas; Mamlouk, Soulafa; Arsie, Roberto; Wei, Tzu-Ting; Klotz-Noack, Kathleen; Schwarz, Roland F; Sawitzki, Birgit; Kamphues, Carsten; Beule, Dieter; Landthaler, Markus; Sers, Christine; Horst, David; Blüthgen, Nils; Morkel, Markus. Mitogen-activated protein kinase activity drives cell trajectories in colorectal cancer. Embo Molecular Medicine. 2021;13(10):e14123. PubMed |