Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)

Catalog No:
ATL-HPA077718-25
$395.00

Description

Product Description

Protein Description: olfactomedin 4
Gene Name: OLFM4
Alternative Gene Name: GC1, GW112, OlfD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022026: 54%, ENSRNOG00000013280: 77%
Entrez Gene ID: 10562
Uniprot ID: Q6UX06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
Gene Sequence KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
Gene ID - Mouse ENSMUSG00000022026
Gene ID - Rat ENSRNOG00000013280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)
Datasheet Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)
Datasheet Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)

Citations

Citations for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) – 1 Found
Uhlitz, Florian; Bischoff, Philip; Peidli, Stefan; Sieber, Anja; Trinks, Alexandra; Lüthen, Mareen; Obermayer, Benedikt; Blanc, Eric; Ruchiy, Yana; Sell, Thomas; Mamlouk, Soulafa; Arsie, Roberto; Wei, Tzu-Ting; Klotz-Noack, Kathleen; Schwarz, Roland F; Sawitzki, Birgit; Kamphues, Carsten; Beule, Dieter; Landthaler, Markus; Sers, Christine; Horst, David; Blüthgen, Nils; Morkel, Markus. Mitogen-activated protein kinase activity drives cell trajectories in colorectal cancer. Embo Molecular Medicine. 2021;13(10):e14123.  PubMed

Product Description

Protein Description: olfactomedin 4
Gene Name: OLFM4
Alternative Gene Name: GC1, GW112, OlfD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022026: 54%, ENSRNOG00000013280: 77%
Entrez Gene ID: 10562
Uniprot ID: Q6UX06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
Gene Sequence KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN
Gene ID - Mouse ENSMUSG00000022026
Gene ID - Rat ENSRNOG00000013280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)
Datasheet Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)
Datasheet Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation)

Citations

Citations for Anti OLFM4 pAb (ATL-HPA077718 w/enhanced validation) – 1 Found
Uhlitz, Florian; Bischoff, Philip; Peidli, Stefan; Sieber, Anja; Trinks, Alexandra; Lüthen, Mareen; Obermayer, Benedikt; Blanc, Eric; Ruchiy, Yana; Sell, Thomas; Mamlouk, Soulafa; Arsie, Roberto; Wei, Tzu-Ting; Klotz-Noack, Kathleen; Schwarz, Roland F; Sawitzki, Birgit; Kamphues, Carsten; Beule, Dieter; Landthaler, Markus; Sers, Christine; Horst, David; Blüthgen, Nils; Morkel, Markus. Mitogen-activated protein kinase activity drives cell trajectories in colorectal cancer. Embo Molecular Medicine. 2021;13(10):e14123.  PubMed