Description
Product Description
Protein Description: olfactomedin 2
Gene Name: OLFM2
Alternative Gene Name: NOE2, OlfC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032172: 100%, ENSRNOG00000020519: 100%
Entrez Gene ID: 93145
Uniprot ID: O95897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: OLFM2
Alternative Gene Name: NOE2, OlfC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032172: 100%, ENSRNOG00000020519: 100%
Entrez Gene ID: 93145
Uniprot ID: O95897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDES |
| Gene Sequence | SLFYNKYQSNVVVKYHFRSRSVLVQRSLPGAGYNNTFPYSWGGFSDMDFMVDES |
| Gene ID - Mouse | ENSMUSG00000032172 |
| Gene ID - Rat | ENSRNOG00000020519 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti OLFM2 pAb (ATL-HPA057771) | |
| Datasheet | Anti OLFM2 pAb (ATL-HPA057771) Datasheet (External Link) |
| Vendor Page | Anti OLFM2 pAb (ATL-HPA057771) at Atlas Antibodies |
| Documents & Links for Anti OLFM2 pAb (ATL-HPA057771) | |
| Datasheet | Anti OLFM2 pAb (ATL-HPA057771) Datasheet (External Link) |
| Vendor Page | Anti OLFM2 pAb (ATL-HPA057771) |