Anti ODF3L2 pAb (ATL-HPA067065)

Catalog No:
ATL-HPA067065-25
$447.00

Description

Product Description

Protein Description: outer dense fiber of sperm tails 3 like 2
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 83%, ENSRNOG00000008199: 81%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Gene Sequence EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Gene ID - Mouse ENSMUSG00000035963
Gene ID - Rat ENSRNOG00000008199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065)
Datasheet Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067065) at Atlas Antibodies

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065)
Datasheet Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067065)

Product Description

Protein Description: outer dense fiber of sperm tails 3 like 2
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 83%, ENSRNOG00000008199: 81%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Gene Sequence EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM
Gene ID - Mouse ENSMUSG00000035963
Gene ID - Rat ENSRNOG00000008199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065)
Datasheet Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067065) at Atlas Antibodies

Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065)
Datasheet Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link)
Vendor Page Anti ODF3L2 pAb (ATL-HPA067065)