Description
Product Description
Protein Description: outer dense fiber of sperm tails 3 like 2
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 83%, ENSRNOG00000008199: 81%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ODF3L2
Alternative Gene Name: C19orf19, FLJ40059
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035963: 83%, ENSRNOG00000008199: 81%
Entrez Gene ID: 284451
Uniprot ID: Q3SX64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM |
Gene Sequence | EIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGPGAHCPEQVTVNKARAPAFSMGIRHSKRASTM |
Gene ID - Mouse | ENSMUSG00000035963 |
Gene ID - Rat | ENSRNOG00000008199 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065) | |
Datasheet | Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link) |
Vendor Page | Anti ODF3L2 pAb (ATL-HPA067065) at Atlas Antibodies |
Documents & Links for Anti ODF3L2 pAb (ATL-HPA067065) | |
Datasheet | Anti ODF3L2 pAb (ATL-HPA067065) Datasheet (External Link) |
Vendor Page | Anti ODF3L2 pAb (ATL-HPA067065) |