Anti ODF3B pAb (ATL-HPA062837 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062837-25

• 

Product Description

Protein Description: outer dense fiber of sperm tails 3B
Gene Name: ODF3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047394: 67%, ENSRNOG00000037060: 66%
Entrez Gene ID: 440836
Uniprot ID: A8MYP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRK
• Gene Sequence: SFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRK
• Gene ID - Mouse: ENSMUSG00000047394
• Gene ID - Rat: ENSRNOG00000037060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.