Description
Product Description
Protein Description: odontogenic, ameloblast associated
Gene Name: ODAM
Alternative Gene Name: APin, FLJ20513
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009580: 67%, ENSRNOG00000023372: 68%
Entrez Gene ID: 54959
Uniprot ID: A1E959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ODAM
Alternative Gene Name: APin, FLJ20513
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009580: 67%, ENSRNOG00000023372: 68%
Entrez Gene ID: 54959
Uniprot ID: A1E959
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGY |
Gene Sequence | PLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGY |
Gene ID - Mouse | ENSMUSG00000009580 |
Gene ID - Rat | ENSRNOG00000023372 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ODAM pAb (ATL-HPA070297) | |
Datasheet | Anti ODAM pAb (ATL-HPA070297) Datasheet (External Link) |
Vendor Page | Anti ODAM pAb (ATL-HPA070297) at Atlas Antibodies |
Documents & Links for Anti ODAM pAb (ATL-HPA070297) | |
Datasheet | Anti ODAM pAb (ATL-HPA070297) Datasheet (External Link) |
Vendor Page | Anti ODAM pAb (ATL-HPA070297) |