Anti NXT2 pAb (ATL-HPA072010)

Catalog No:
ATL-HPA072010-25
$303.00

Description

Product Description

Protein Description: nuclear transport factor 2-like export factor 2
Gene Name: NXT2
Alternative Gene Name: P15-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032911: 34%, ENSRNOG00000017208: 34%
Entrez Gene ID: 55916
Uniprot ID: Q9NPJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLD
Gene Sequence KYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLD
Gene ID - Mouse ENSMUSG00000032911
Gene ID - Rat ENSRNOG00000017208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NXT2 pAb (ATL-HPA072010)
Datasheet Anti NXT2 pAb (ATL-HPA072010) Datasheet (External Link)
Vendor Page Anti NXT2 pAb (ATL-HPA072010) at Atlas Antibodies

Documents & Links for Anti NXT2 pAb (ATL-HPA072010)
Datasheet Anti NXT2 pAb (ATL-HPA072010) Datasheet (External Link)
Vendor Page Anti NXT2 pAb (ATL-HPA072010)

Product Description

Protein Description: nuclear transport factor 2-like export factor 2
Gene Name: NXT2
Alternative Gene Name: P15-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032911: 34%, ENSRNOG00000017208: 34%
Entrez Gene ID: 55916
Uniprot ID: Q9NPJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLD
Gene Sequence KYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLD
Gene ID - Mouse ENSMUSG00000032911
Gene ID - Rat ENSRNOG00000017208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NXT2 pAb (ATL-HPA072010)
Datasheet Anti NXT2 pAb (ATL-HPA072010) Datasheet (External Link)
Vendor Page Anti NXT2 pAb (ATL-HPA072010) at Atlas Antibodies

Documents & Links for Anti NXT2 pAb (ATL-HPA072010)
Datasheet Anti NXT2 pAb (ATL-HPA072010) Datasheet (External Link)
Vendor Page Anti NXT2 pAb (ATL-HPA072010)