Protein Description: NACHT and WD repeat domain containing 1
Gene Name: NWD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048148: 73%, ENSRNOG00000052129: 76%
Entrez Gene ID: 284434
Uniprot ID: Q149M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NWD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048148: 73%, ENSRNOG00000052129: 76%
Entrez Gene ID: 284434
Uniprot ID: Q149M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ATVFLREIQDLHKHILEDCALRMVDRLADGCLDTDAQNLLSSLKSHITDMHPGVLKTHRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLT |
| Documents & Links for Anti NWD1 pAb (ATL-HPA075476) | |
| Datasheet | Anti NWD1 pAb (ATL-HPA075476) Datasheet (External Link) |
| Vendor Page | Anti NWD1 pAb (ATL-HPA075476) at Atlas |
| Documents & Links for Anti NWD1 pAb (ATL-HPA075476) | |
| Datasheet | Anti NWD1 pAb (ATL-HPA075476) Datasheet (External Link) |
| Vendor Page | Anti NWD1 pAb (ATL-HPA075476) |