Protein Description: nucleoporin 98kDa
Gene Name: NUP98
Alternative Gene Name: NUP96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063550: 84%, ENSRNOG00000020347: 85%
Entrez Gene ID: 4928
Uniprot ID: P52948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUP98
Alternative Gene Name: NUP96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063550: 84%, ENSRNOG00000020347: 85%
Entrez Gene ID: 4928
Uniprot ID: P52948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQ |
| Documents & Links for Anti NUP98 pAb (ATL-HPA074810) | |
| Datasheet | Anti NUP98 pAb (ATL-HPA074810) Datasheet (External Link) |
| Vendor Page | Anti NUP98 pAb (ATL-HPA074810) at Atlas |
| Documents & Links for Anti NUP98 pAb (ATL-HPA074810) | |
| Datasheet | Anti NUP98 pAb (ATL-HPA074810) Datasheet (External Link) |
| Vendor Page | Anti NUP98 pAb (ATL-HPA074810) |
| Citations for Anti NUP98 pAb (ATL-HPA074810) – 1 Found |
| Meyers, Jordan M; Ramanathan, Muthukumar; Shanderson, Ronald L; Beck, Aimee; Donohue, Laura; Ferguson, Ian; Guo, Margaret G; Rao, Deepti S; Miao, Weili; Reynolds, David; Yang, Xue; Zhao, Yang; Yang, Yen-Yu; Blish, Catherine; Wang, Yinsheng; Khavari, Paul A. The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation. Plos Pathogens. 2021;17(10):e1009412. PubMed |