Protein Description: nucleoporin 37kDa
Gene Name: NUP37
Alternative Gene Name: FLJ22618, MGC5585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035351: 91%, ENSRNOG00000004727: 91%
Entrez Gene ID: 79023
Uniprot ID: Q8NFH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUP37
Alternative Gene Name: FLJ22618, MGC5585
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035351: 91%, ENSRNOG00000004727: 91%
Entrez Gene ID: 79023
Uniprot ID: Q8NFH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQ |
| Documents & Links for Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) | |
| Datasheet | Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) at Atlas |
| Documents & Links for Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) | |
| Datasheet | Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NUP37 pAb (ATL-HPA073708 w/enhanced validation) |