Protein Description: nucleoporin 210kDa-like
Gene Name: NUP210L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027939: 78%, ENSRNOG00000055790: 78%
Entrez Gene ID: 91181
Uniprot ID: Q5VU65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUP210L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027939: 78%, ENSRNOG00000055790: 78%
Entrez Gene ID: 91181
Uniprot ID: Q5VU65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YVCIIKVRPQSEELLQALSVADTSVYGWATLVSERSKNGMQRILIPFIPAFYINQSELVLSHKQDIGEIRVLGVDRVLRKLE |
| Documents & Links for Anti NUP210L pAb (ATL-HPA066707) | |
| Datasheet | Anti NUP210L pAb (ATL-HPA066707) Datasheet (External Link) |
| Vendor Page | Anti NUP210L pAb (ATL-HPA066707) at Atlas |
| Documents & Links for Anti NUP210L pAb (ATL-HPA066707) | |
| Datasheet | Anti NUP210L pAb (ATL-HPA066707) Datasheet (External Link) |
| Vendor Page | Anti NUP210L pAb (ATL-HPA066707) |