Anti NUP188 pAb (ATL-HPA063942)

Catalog No:
ATL-HPA063942-25
$303.00

Description

Product Description

Protein Description: nucleoporin 188kDa
Gene Name: NUP188
Alternative Gene Name: KIAA0169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052533: 96%, ENSRNOG00000025185: 96%
Entrez Gene ID: 23511
Uniprot ID: Q5SRE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR
Gene Sequence APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR
Gene ID - Mouse ENSMUSG00000052533
Gene ID - Rat ENSRNOG00000025185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NUP188 pAb (ATL-HPA063942)
Datasheet Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA063942) at Atlas Antibodies

Documents & Links for Anti NUP188 pAb (ATL-HPA063942)
Datasheet Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA063942)

Product Description

Protein Description: nucleoporin 188kDa
Gene Name: NUP188
Alternative Gene Name: KIAA0169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052533: 96%, ENSRNOG00000025185: 96%
Entrez Gene ID: 23511
Uniprot ID: Q5SRE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR
Gene Sequence APMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSDGSKEFSLGMWSCLHAVLELIDSQQQDR
Gene ID - Mouse ENSMUSG00000052533
Gene ID - Rat ENSRNOG00000025185
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NUP188 pAb (ATL-HPA063942)
Datasheet Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA063942) at Atlas Antibodies

Documents & Links for Anti NUP188 pAb (ATL-HPA063942)
Datasheet Anti NUP188 pAb (ATL-HPA063942) Datasheet (External Link)
Vendor Page Anti NUP188 pAb (ATL-HPA063942)