Description
Product Description
Protein Description: numb homolog (Drosophila)-like
Gene Name: NUMBL
Alternative Gene Name: CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063160: 96%, ENSRNOG00000020867: 94%
Entrez Gene ID: 9253
Uniprot ID: Q9Y6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUMBL
Alternative Gene Name: CAG3A, CTG3a, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063160: 96%, ENSRNOG00000020867: 94%
Entrez Gene ID: 9253
Uniprot ID: Q9Y6R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP |
| Gene Sequence | NELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAP |
| Gene ID - Mouse | ENSMUSG00000063160 |
| Gene ID - Rat | ENSRNOG00000020867 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti NUMBL pAb (ATL-HPA058380) | |
| Datasheet | Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link) |
| Vendor Page | Anti NUMBL pAb (ATL-HPA058380) at Atlas Antibodies |
| Documents & Links for Anti NUMBL pAb (ATL-HPA058380) | |
| Datasheet | Anti NUMBL pAb (ATL-HPA058380) Datasheet (External Link) |
| Vendor Page | Anti NUMBL pAb (ATL-HPA058380) |