Description
Product Description
Protein Description: nuclear fragile X mental retardation protein interacting protein 2
Gene Name: NUFIP2
Alternative Gene Name: 182-FIP, 82-FIP, FIP-82, KIAA1321, MGC117262, PIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037857: 92%, ENSRNOG00000024964: 93%
Entrez Gene ID: 57532
Uniprot ID: Q7Z417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUFIP2
Alternative Gene Name: 182-FIP, 82-FIP, FIP-82, KIAA1321, MGC117262, PIG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037857: 92%, ENSRNOG00000024964: 93%
Entrez Gene ID: 57532
Uniprot ID: Q7Z417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG |
Gene Sequence | NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG |
Gene ID - Mouse | ENSMUSG00000037857 |
Gene ID - Rat | ENSRNOG00000024964 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NUFIP2 pAb (ATL-HPA067443) | |
Datasheet | Anti NUFIP2 pAb (ATL-HPA067443) Datasheet (External Link) |
Vendor Page | Anti NUFIP2 pAb (ATL-HPA067443) at Atlas Antibodies |
Documents & Links for Anti NUFIP2 pAb (ATL-HPA067443) | |
Datasheet | Anti NUFIP2 pAb (ATL-HPA067443) Datasheet (External Link) |
Vendor Page | Anti NUFIP2 pAb (ATL-HPA067443) |