Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 6
Gene Name: NUDT6
Alternative Gene Name: FGF-AS, FGF2AS, gfg, gfg-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050174: 88%, ENSRNOG00000017420: 89%
Entrez Gene ID: 11162
Uniprot ID: P53370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUDT6
Alternative Gene Name: FGF-AS, FGF2AS, gfg, gfg-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050174: 88%, ENSRNOG00000017420: 89%
Entrez Gene ID: 11162
Uniprot ID: P53370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HIPILQSRFIAPAASLGFRFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGD |
| Documents & Links for Anti NUDT6 pAb (ATL-HPA066115) | |
| Datasheet | Anti NUDT6 pAb (ATL-HPA066115) Datasheet (External Link) |
| Vendor Page | Anti NUDT6 pAb (ATL-HPA066115) at Atlas |
| Documents & Links for Anti NUDT6 pAb (ATL-HPA066115) | |
| Datasheet | Anti NUDT6 pAb (ATL-HPA066115) Datasheet (External Link) |
| Vendor Page | Anti NUDT6 pAb (ATL-HPA066115) |