Anti NUDT6 pAb (ATL-HPA066115)

Atlas Antibodies

Catalog No: ATL-HPA066115-25

• 

Product Description

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 6
Gene Name: NUDT6
Alternative Gene Name: FGF-AS, FGF2AS, gfg, gfg-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050174: 88%, ENSRNOG00000017420: 89%
Entrez Gene ID: 11162
Uniprot ID: P53370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HIPILQSRFIAPAASLGFRFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGD
• Gene Sequence: HIPILQSRFIAPAASLGFRFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGD
• Gene ID - Mouse: ENSMUSG00000050174
• Gene ID - Rat: ENSRNOG00000017420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.