Anti NUDT3 pAb (ATL-HPA055953)

Atlas Antibodies

Catalog No: ATL-HPA055953-25

• 

Product Description

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Name: NUDT3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024213: 77%, ENSRNOG00000061176: 80%
Entrez Gene ID: 11165
Uniprot ID: O95989
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRQGYSANNGTPVVATTYSVSAQSSMSGIR
• Gene Sequence: LRQGYSANNGTPVVATTYSVSAQSSMSGIR
• Gene ID - Mouse: ENSMUSG00000024213
• Gene ID - Rat: ENSRNOG00000061176
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.