Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 21
Gene Name: NUDT21
Alternative Gene Name: CFIM25, CPSF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031754: 100%, ENSRNOG00000042983: 100%
Entrez Gene ID: 11051
Uniprot ID: O43809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUDT21
Alternative Gene Name: CFIM25, CPSF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031754: 100%, ENSRNOG00000042983: 100%
Entrez Gene ID: 11051
Uniprot ID: O43809
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG |
| Documents & Links for Anti NUDT21 pAb (ATL-HPA074228) | |
| Datasheet | Anti NUDT21 pAb (ATL-HPA074228) Datasheet (External Link) |
| Vendor Page | Anti NUDT21 pAb (ATL-HPA074228) at Atlas |
| Documents & Links for Anti NUDT21 pAb (ATL-HPA074228) | |
| Datasheet | Anti NUDT21 pAb (ATL-HPA074228) Datasheet (External Link) |
| Vendor Page | Anti NUDT21 pAb (ATL-HPA074228) |