Anti NUDT2 pAb (ATL-HPA067639)

Atlas Antibodies

Catalog No: ATL-HPA067639-25

• 

Product Description

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 2
Gene Name: NUDT2
Alternative Gene Name: APAH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028443: 89%, ENSRNOG00000013110: 91%
Entrez Gene ID: 318
Uniprot ID: P50583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
• Gene Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
• Gene ID - Mouse: ENSMUSG00000028443
• Gene ID - Rat: ENSRNOG00000013110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.