Description
Product Description
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 2
Gene Name: NUDT2
Alternative Gene Name: APAH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028443: 89%, ENSRNOG00000013110: 91%
Entrez Gene ID: 318
Uniprot ID: P50583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NUDT2
Alternative Gene Name: APAH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028443: 89%, ENSRNOG00000013110: 91%
Entrez Gene ID: 318
Uniprot ID: P50583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
Gene Sequence | MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR |
Gene ID - Mouse | ENSMUSG00000028443 |
Gene ID - Rat | ENSRNOG00000013110 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti NUDT2 pAb (ATL-HPA067639) | |
Datasheet | Anti NUDT2 pAb (ATL-HPA067639) Datasheet (External Link) |
Vendor Page | Anti NUDT2 pAb (ATL-HPA067639) at Atlas Antibodies |
Documents & Links for Anti NUDT2 pAb (ATL-HPA067639) | |
Datasheet | Anti NUDT2 pAb (ATL-HPA067639) Datasheet (External Link) |
Vendor Page | Anti NUDT2 pAb (ATL-HPA067639) |