Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)

Catalog No:
ATL-HPA074873-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Description

Product Description

Protein Description: neurotrophic receptor tyrosine kinase 2
Gene Name: NTRK2
Alternative Gene Name: TRKB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055254: 92%, ENSRNOG00000018839: 92%
Entrez Gene ID: 4915
Uniprot ID: Q16620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
Gene Sequence INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
Gene ID - Mouse ENSMUSG00000055254
Gene ID - Rat ENSRNOG00000018839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)
Datasheet Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)
Datasheet Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)

Product Description

Protein Description: neurotrophic receptor tyrosine kinase 2
Gene Name: NTRK2
Alternative Gene Name: TRKB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055254: 92%, ENSRNOG00000018839: 92%
Entrez Gene ID: 4915
Uniprot ID: Q16620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
Gene Sequence INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS
Gene ID - Mouse ENSMUSG00000055254
Gene ID - Rat ENSRNOG00000018839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)
Datasheet Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)
Datasheet Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK2 pAb (ATL-HPA074873 w/enhanced validation)