Immunohistochemistry analysis in human adrenal gland and prostate tissues using HPA035799 antibody. Corresponding NTRK1 RNA-seq data are presented for the same tissues.

Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation)

Catalog No:
ATL-HPA035799-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: neurotrophic tyrosine kinase, receptor, type 1
Gene Name: NTRK1
Alternative Gene Name: MTC, TRK, TRKA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028072: 82%, ENSRNOG00000013953: 84%
Entrez Gene ID: 4914
Uniprot ID: P04629
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG

Documents & Links for Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation)
Datasheet Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation) at Atlas

Documents & Links for Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation)
Datasheet Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NTRK1 pAb (ATL-HPA035799 w/enhanced validation)