Protein Description: netrin G2
Gene Name: NTNG2
Alternative Gene Name: KIAA1857, Lmnt2, NTNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035513: 89%, ENSRNOG00000013694: 91%
Entrez Gene ID: 84628
Uniprot ID: Q96CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: NTNG2
Alternative Gene Name: KIAA1857, Lmnt2, NTNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035513: 89%, ENSRNOG00000013694: 91%
Entrez Gene ID: 84628
Uniprot ID: Q96CW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KEEEGLATYWQSITWSRYPSPLEANITLSWNKTVELTDDVVMTFEYG |
Documents & Links for Anti NTNG2 pAb (ATL-HPA071290) | |
Datasheet | Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link) |
Vendor Page | Anti NTNG2 pAb (ATL-HPA071290) at Atlas |
Documents & Links for Anti NTNG2 pAb (ATL-HPA071290) | |
Datasheet | Anti NTNG2 pAb (ATL-HPA071290) Datasheet (External Link) |
Vendor Page | Anti NTNG2 pAb (ATL-HPA071290) |