Anti NTNG1 pAb (ATL-HPA065954)

Catalog No:
ATL-HPA065954-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: netrin G1
Gene Name: NTNG1
Alternative Gene Name: KIAA0976, Lmnt1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059857: 89%, ENSRNOG00000013694: 49%
Entrez Gene ID: 22854
Uniprot ID: Q9Y2I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
Gene ID - Mouse ENSMUSG00000059857
Gene ID - Rat ENSMUSG00000059857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti NTNG1 pAb (ATL-HPA065954)
Datasheet Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link)
Vendor Page Anti NTNG1 pAb (ATL-HPA065954) at Atlas

Documents & Links for Anti NTNG1 pAb (ATL-HPA065954)
Datasheet Anti NTNG1 pAb (ATL-HPA065954) Datasheet (External Link)
Vendor Page Anti NTNG1 pAb (ATL-HPA065954)